PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02291g04002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 565aa    MW: 63418.5 Da    PI: 4.8757
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02291g04002.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS442.53e-1351975653374
                      GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsev 87 
                               + L++cA a+++g+ e+a++++++l++++s +g+p++R aay++eALaar+a s+++lykal+++e+     se+l+a+++++ev
  Niben101Scf02291g04002.1 197 QMLFSCAAAIQDGNIEQASSMINELRQMVSIQGEPLERTAAYMVEALAARVATSGKGLYKALKCKEAL---FSERLSAMQVLFEV 278
                               79*****************************************************************8...9************* PP

                      GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAe 170
                               +P+++f++++aN aIlea++ e+rvHiiDfdi+qG Q+ +Llq+L   p++pp+lR+Tgv++p s+      l+ +g rL+++A+
  Niben101Scf02291g04002.1 279 CPYFRFGFMAANGAILEAFKDEKRVHIIDFDINQGSQYYTLLQTLERMPGKPPHLRLTGVDDPVSVqrAIGGLNVIGLRLEELAK 363
                               ***************************************************************999777789************* PP

                      GRAS 171 elgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFle 255
                                +++pfef++ va++++ +++ +L+++pgEal+Vn+++qlh+++desvs+ ++rd++L++vksl+Pk+v+vveq++++n+++Fl+
  Niben101Scf02291g04002.1 364 DFKIPFEFQA-VASNTALVTPAMLNCHPGEALIVNFAFQLHHMPDESVSTVNQRDQLLRMVKSLNPKLVTVVEQDMNTNTTPFLQ 447
                               **********.7************************************************************************* PP

                      GRAS 256 rflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakll 340
                               r++e  +yysa+f+sl+a+l+r+s+er++vEr++l+r+ivn+vaceg+er+er e ++kWr+r+++aGF+p p+s +++ +++ l
  Niben101Scf02291g04002.1 448 RVAEVYNYYSAVFESLDATLSRDSQERVNVERQCLARDIVNIVACEGEERIERYEVAGKWRARMMMAGFTPSPISRNVYYSIQNL 532
                               ************************************************************************************* PP

                      GRAS 341 lrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               +++++++ y+ +ee g+l +gW+d++L+++SaW+
  Niben101Scf02291g04002.1 533 IKQYSER-YKAKEEAGALHFGWEDKSLIVASAWK 565
                               *****66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.579169546IPR005202Transcription factor GRAS
PfamPF035141.0E-132197565IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 565 aa     Download sequence    Send to blast
MSLVRSVRTI GNGKLYFPND HNDNSGLSTS MFTKNARGIM YATESSSTDS YDPKYLLDSP  60
SPSEELLNTS LSEVSGNQFH QRHSSSFQPS RGYDTCQLSY DCEDIVSQRP DSLQYNDGRV  120
TLKLQELESV LFDDNEVDGD DVFARGKCMD IDEEWFSQIG TVLLHDSPKE STSADSNISS  180
SSIYKEISVT APQTPKQMLF SCAAAIQDGN IEQASSMINE LRQMVSIQGE PLERTAAYMV  240
EALAARVATS GKGLYKALKC KEALFSERLS AMQVLFEVCP YFRFGFMAAN GAILEAFKDE  300
KRVHIIDFDI NQGSQYYTLL QTLERMPGKP PHLRLTGVDD PVSVQRAIGG LNVIGLRLEE  360
LAKDFKIPFE FQAVASNTAL VTPAMLNCHP GEALIVNFAF QLHHMPDESV STVNQRDQLL  420
RMVKSLNPKL VTVVEQDMNT NTTPFLQRVA EVYNYYSAVF ESLDATLSRD SQERVNVERQ  480
CLARDIVNIV ACEGEERIER YEVAGKWRAR MMMAGFTPSP ISRNVYYSIQ NLIKQYSERY  540
KAKEEAGALH FGWEDKSLIV ASAWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-581975656375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009628414.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_009628413.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_009628412.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_009628411.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_009628410.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016501232.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016501231.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016501230.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016501228.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016501227.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016501226.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLQ00LP30.0Q00LP3_SOLLC; GRAS6
STRINGSolyc04g064550.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA89672429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1